General Information

  • ID:  hor001206
  • Uniprot ID:  O44185
  • Protein name:  FLP-13
  • Gene name:  flp-13
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed from the comma stage of embryogenesis, during all larval stages, and in low levels in adults . |Expressed in the ASE sensory neurons, the DD motor neurons, the 15, M3 and M5 cholinergic pharyngeal motoneurons, and the ASG, ASK and BAG neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045187 regulation of circadian sleep/wake cycle, sleep; GO:1900034 regulation of cellular response to heat
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SAAAPLIRFG
  • Length:  10(138-147)
  • Propeptide:  MMTSLLTISMFVVAIQAFDSSEIRMLDEQYDTKNPFFQFLENSKRSDRPTRAMDSPLIRFGKRAADGAPLIRFGRAPEASPFIRFGKRAADGAPLIRFGRAPEASPFIRFGKRASPSAPLIRFGRSPSAVPLIRFGRSAAAPLIRFGRASSAPLIRFGRK
  • Signal peptide:  MMTSLLTISMFVVAIQA
  • Modification:  T9 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Probable FMRFamide-like neuropeptides (PubMed:28094002, PubMed:16377032). Binds to neuronal receptors such as dmsr-1 to promote sleep in response to cellular stress also known as stress-induced sleep (SIS) (PubMed:28094002). Plays a role in behaviors asso
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O44185-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001206_AF2.pdbhor001206_ESM.pdb

Physical Information

Mass: 116290 Formula: C46H75N13O12
Absent amino acids: CDEHKMNQTVWY Common amino acids: A
pI: 10.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 6
Hydrophobicity: 92 Boman Index: 87
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 108
Instability Index: 2826 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17564681
  • Title:  Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry.